POSA Home | FATCAT | Other Servers | Godzik Lab | Sanford Burnham Prebys Medical Discovery Institute | Contact Us



The protein structure alignment is calculated on the following chains: 2d9h:A; 2adr:A; 4gzn:C; 1x6e:A; 2cot:A; 2drp:A(110-135, in grey);

After structure superposition, other chains that are added to the superimposed structures are: 4gzn:A,B; 2drp:B,C.

        /2d9hA.pdb/ /A/ 1    6    11   16   21   26   31   36   41   46   51   56   61   66   71   76   
GSSGSSGLQCEICGFTCRQKASLNWHQRKHAETVAALRFPCEFCGKRFEKPDSVAAHRSKSHPALLLAPQESSGPSSG
        /2adrA.pdb/ /A/ 102  107  112  117  122  127  132  137  142  147  152  157  
RSFVCEVCTRAFARQEHLKRHYRSHTNEKPYPCGLCNRAFTRRDLLIRHAQKIHSGNLGE
      /4gznCAB.pdb/ /C/ 136  141  146  151  156  161  166  171  176  181  186  191  202  /A/ 1    6    11   /B/ 1    6    11   
SERPFFCNFCGKTYRDASGLSRHRRAHLGYRPRSCPECGKCFRDQSEVNRHLKVHQNKPXXXXX TATTGCXGCAG ACTGXGGCAATX
        /1x6eA.pdb/ /A/ 1    6    11   16   21   26   31   36   41   46   51   56   61   66   71   
GSSGSSGIHSGEKPYGCVECGKAFSRSSILVQHQRVHTGEKPYKCLECGKAFSQNSGLINHQRIHTSGPSSG
        /2cotA.pdb/ /A/ 1    6    11   16   21   26   31   36   41   46   51   56   61   66   71   76   
GSSGSSGRSEWQQRERRRYKCDECGKSFSHSSDLSKHRRTHTGEKPYKCDECGKAFIQRSHLIGHHRVHTGSGPSSG
      /2drpABC.pdb/ /A/ 103  108  113  118  123  128  133  138  143  148  153  158  163  /B/ 1    6    11   16   /C/ 21   26   31   36   
FTKEGEHTYRCKVCSRVYTHISNFCRHYVTSHKRNVKVYPCPFCFKEFTRKDNMTAHVKIIHKXX CTAATAAGGATAACGTCCG TCGGACGTTATCCTTATTA
ColorPDBAligned Chain/SegmentsOther ChainsShow Ligands

Download a UCSF Chimera script for publication ready visualization and multiple analysis tools here. Start chimera and use "Open" menu to open the downloaded script. Please note, you must have access to the internet to download the aligned structures.
zincFingerSegRef.pdb
2d9hA.pdb   
2adrA.pdb   
4gznCAB.pdb   
1x6eA.pdb   
2cotA.pdb   
2drpABC.pdb   
  |     |     |  3D viewer: JSmol. Try alternative viewer Jmol   |  Jmol tips and trouble shooting