POSA Home | FATCAT | Other Servers | Godzik Lab | Sanford Burnham Prebys Medical Discovery Institute | Contact Us



The protein structure alignment is calculated on the following chains: 3ngb:G; 4j6r:G; 4jm2:E;

After structure superposition, other chains that are added to the superimposed structures are: 3ngb:H,L; 4j6r:H,L; 4jm2:A,B.

#segment   S1                                     S2                                                                                                      S3                                                                     S4                                                                                  
3ngbG  {45}VTENFNMWKNNMVEQMQEDVISLWDQSLQPCVKLTG{0}GSVIKQACPKISFDPIPIHYCTPAGYVILKCNDKNFNGTGPCKNVSSVQCTHGIKPVVSTQLLLNGSLAEEEIIIRSENLTNNAKTIIVHLNKSVEINCTR{4}DIRKAYCEINGTKWNKVLKQVTEKLKEHFNNKTIIFQPPSGGDLEITMHHFNCRGEFFYCNTTQLFN{12}NGTITLPCKIKQIINMWQGTGQAMYAPPIDGKINCVSNITGILLTRDGGANNTSNETFRPGGGNIKDNWRSELYKYKVVQI{1}
4j6rG  {45}VTEKFNMWKNNMVEQMHTDIISLWDQSLKPCVKLTG{0}GSAITQACPKVSFEPIPIHYCTPAGFAILKCKDEGFNGTGLCKNVSTVQCTHGIKPVVSTQLLLNGSLAEKNITIRSENITNNAKIIIVQLVQPVTIKCIR{0}DIRQAHCNVTRSRWNKTLQEVAEKLRTYFGNKTIIFANSSGGDLEITTHSFNCGGEFFYCNTSGLFN{12}NDTITLPCRIKQIINMWQRAGQAMYAPPIPGVIKCESNITGLLLTRDGGKDNNVNETFRPGGGDMRDNWRSELYKYKVVEI{1}
4jm2E  { 0}VTEHFNMWKNNMVEQMQEDIISLWDQSLKPCVKLTP{9}TSVITQACPKISFEPIPIHYCAPAGFAILKCNDKTFNGKGPCKNVSTVQCTHGIRPVVSTQLLLNGSLAEEEVVIRSDNFTNNAKTIIVQLKESVEINCTR{7}DIRQAHCNISRAKWNDTLKQIVIKLREQFENKTIVFNHSSGGDPEIVMHSFNCGGEFFYCNSTQLFN{14}GNTITLPCRIKQIINMWQEVGKAMYAPPIRGQIRCSSNITGLLLTRDGGINENGTEIFRPGGGDMRDNWRSELYKYKVVKI{0}
ColorPDBAligned Chain/SegmentsOther ChainsShow Ligands

common core regions

Download a UCSF Chimera script for publication ready visualization and multiple analysis tools here. Start chimera and use "Open" menu to open the downloaded script. Please note, you must have access to the internet to download the aligned structures.
PGT135_VRC01_VRC23_G.pdb
3ngbGHL.pdb   
4j6rGHL.pdb   
4jm2EAB.pdb   
  |     |     |  3D viewer: Jmol. Try alternative viewer JSmol   |  Jmol tips and trouble shooting